PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G02610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 427aa    MW: 47103.6 Da    PI: 6.567
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G02610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  OMERI05G02610.1 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.15.6e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  OMERI05G02610.1  67 RGAFSQEEEDLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.6961IPR017930Myb domain
SuperFamilySSF466891.24E-2912108IPR009057Homeodomain-like
SMARTSM007175.0E-121363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001673.55E-111761No hitNo description
PROSITE profilePS5129425.61562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
SMARTSM007175.8E-1366114IPR001005SANT/Myb domain
PfamPF002499.2E-1467110IPR001005SANT/Myb domain
CDDcd001678.51E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQKG  120
IDPNTHKPLT EADRRGAAPT VSTERTSGSS DVNPSSAGAL GNLSHLLSET AQSSILLPVY  180
DKNHPETASL PRPKVPPKEL FLDQLTAGHE SPSSCRSSGP TLYFPFQQPL GYGNECGTGD  240
GASMNSLWFN QNDFNCSTIS TVMPPVSPSA LSTSMGLNLP PENPRHGGTG IGNTPFYWDG  300
SNPSSSGSTG SSGSNSMGFE PQSTTSILEN SVFPWTDIGQ EKDTRVHLVE ELKWPDLLHG  360
TFAEATTAMQ NQSQSLYDDV IKAESQFNME GICASWFQNQ QPQQQLQAAS DMYDKDLQRL  420
PLSFEHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4957840.0AJ495784.1 Oryza sativa Japonica Group mRNA for MYB16 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637582.10.0PREDICTED: transcription factor MYB28
TrEMBLA0A0E0DLQ70.0A0A0E0DLQ7_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g04820.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA019160-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.18e-90myb domain protein 61